Essay on “Microsoft Corporation –

Words: 1049
Pages: 5
Open Document
ASSIGNMENT OF BUSINESS TO BUSINESS

“MICROSOFT CORPORATION –
THE DESIGN OF MICROSOFT SUPPORT NETWORK 1.0”

BY

KUNAL CHAKRABARTI, EPGP-03-042
SABYASACHI MAHAPATRA, EPGP-03-072
SOURAV MISHRA, EPGP-03-237

BACKGROUND:
 Microsoft Product Support Services (PSS) is the group who answers the phone when you call technical support for help. When you call PSS, the tech support representative will ask you how you're going to pay for the call. Rates vary depending on whether you have a support contract
 PSS also gives feedback to Microsoft development groups for use in the development of future products or product features.
 Trish May, the Director of Marketing for the PSS of and her boss, Patty Stonesifer, the …show more content…
They included other software companies (e.g., Lotus, WordPerfect), value added resellers (VARs), independent service vendors (ISVs), and firms that developed software for their own internal use. They were prospects for all Microsoft products.
THE FORCES OF CHANGE:
 Financial Performance - By 1990, many software products had reached the “mature” phase of the life cycle. With shrinking margins, producers had no choice but to scrutinize all costs. One prime target for cost reduction was support service. With the average cost of support services for high-end products exceeding 10% of dollar sales, the practice of offering unlimited, free service was doomed. At Microsoft, a defining event came on July 1, 1991 when an Activity Based Costing (ABC) System was implemented.
 Customer Base - The marketplace for software was becoming more and more fragmented. Given Microsoft’s extensive product line, customers ranged across a broad spectrum from home users to global corporations. Each group not only wanted more customized software but also more customized technical support.
 The Competition - Competitors were relying upon a variety of approaches to charge customers for telephone service calls. Some sent an invoice following the call. Others charged via 900# or had service engineers take credit card numbers. Alternatively, some competitors either included in software packages or sold separately “incident coupons” that entitled the bearer to make a number
Show More

Related Documents: Essay on “Microsoft Corporation –

Financial Report Part 1 Microsoft Corporation Essay

MICROSOFT CORPORATION records their assets in their yearly statement, which is provided to the general public in June of every year. The assets mentioned on their balance sheet are mentioned in sequence of liquidity to ensure that an investor can figure out just how much available money they've in the case they require the capital for growth, debts, etc. (Kimmel, Weygandt, Kieso, 2011). It's important for administration to be conscious of business asset levels to ensure that important decisions may…

Words 1252 - Pages 6

Essay on Stock Project

Executive Summary During November, Microsoft, Dell, Sina Corp, and Sohu Media’s common stock performance were tracked and followed. These companies were picked on individual preferences and will be compared to the S&P 500’s performance for the same time period. This was done to see if the performances of randomly picked stocks deviate far from the performance of the market as a whole. This month had two events that had substantial effect on the market, . Hurricane sandy closed the stock market for…

Words 582 - Pages 3

Configure Sql Essay

INSTALLING MICROSOFT SQL SERVER AND CONFIGURING REPORTING SERVICES TECHNICAL ARTICLE November 2012 Copyright © 2012 NetWrix Corporation. All Rights Reserved. Installing Microsoft SQL Server and Configuring Reporting Services Legal Notice The information in this publication is furnished for information use only, and does not constitute a commitment from NetWrix Corporation of any features or functions discussed. NetWrix Corporation assumes no responsibility or liability for the accuracy…

Words 3037 - Pages 13

Essay Microsoft Windows and Adobe Reader

of Adobe Reader for Windows®, Mac, or Linux® by visiting http://www.adobe.com/go/reader_download. For more assistance with Adobe Reader visit http://www.adobe.com/go/acrreader. Windows is either a registered trademark or a trademark of Microsoft Corporation in the United States and/or other countries. Mac is a trademark of Apple Inc., registered in thae United States and other countries. Linux is the registered trademark of Linus Torvalds in the U.S. and other countries. dsaaaaaaaasakasfdkwfpwkfmsdlfkpwjkfm…

Words 1879 - Pages 8

Essay on microsoft anaylsis

For years the Microsoft Corporation has been the go- to business for any form of electronic. Always being in the cutting- edge forefront of the electronic frontier, things are in fact changing with the current times. Through a series of events, not entirely of their own making, there is evidence to suggest that Microsoft is slipping from top- dog to the position of a successful company that is just not as formidable as it has been in previous years. The Microsoft Corporation Technology is…

Words 859 - Pages 4

Microsoft IP Ventures Essay

demanding that Microsoft interact with other providers. This is also beneficial for Microsoft since their Research and Development expenses can be fully utilized. IP ventures aimed to smooth relations with entrepreneurs and venture capitalists, increase researcher morale, and keep abreast of developments in the broader technology field. This is done by offering technology to the venture capital community in exchange for equity. IP ventures will have an observer seat on the board. Microsoft supplies public…

Words 463 - Pages 2

Microsoft Debate Essay

Name Bibles Microeconomics 10 February 2014 Microsoft Debate There was a debate over the status of Microsoft Corporation from a business standpoint. They supply the operating system to about ninety percent of computers but they do not have a clear-cut competitor when it comes to prices. Does this make them a monopoly? Do they purposefully keep prices low to discourage other computer companies from being able to compete with them? The question for lawmakers became: “Does Microsoft’s…

Words 512 - Pages 3

Marketing Mix Essay

that it needs. Microsoft, the industry leader in software development and sales, became a registered trademark on November 26, 1976. Microsoft Windows and Microsoft Office have been the best selling products for the corporation giant. In addition, Microsoft also had a hand in other markets, such as MSNBC cable television network, Microsoft multimedia encyclopedia and the MSN Internet portal, computer hardware, home entertainment products, and gaming consoles. As of 2006, Microsoft employs more than…

Words 1270 - Pages 6

Marketing: Operating System and Microsoft Office Essay

Microsoft Corporation /ˈmaɪkrɵˌsɒft/ or /-ˌsɔːft/[4] is an American multinational corporation headquartered in Redmond, Washington, that develops, manufactures, licenses, supports and sells computer software, consumer electronics and personal computers and services. Its best known software products are the Microsoft Windows line of operating systems, Microsoft Office office suite, and Internet Explorer web browser. Its flagship hardware products are Xbox game console and the Microsoft Surface series…

Words 325 - Pages 2

Essay Meeting: Marketing and Samsung

Microsoft and Samsung Name: Institution: Course: Date: Microsoft and Samsung Introduction Marketing strategies are ways in which an organisation positions itself in the market where it operates and towards its competitors in the same industry (Ranchhod & Gurau, 2007). The aim of marketing strategies is to give the company a competitive edge over their competitors. Marketing strategies should be developed and implemented in order to utilise the organisation’s strengths. This is in taking advantage…

Words 2806 - Pages 12